![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) ![]() |
![]() | Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
![]() | Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species) |
![]() | Species Desulfovibrio africanus [TaxId:873] [54890] (10 PDB entries) |
![]() | Domain d2c3oa5: 2c3o A:669-785 [129754] Other proteins in same PDB: d2c3oa1, d2c3oa2, d2c3oa3, d2c3oa4, d2c3ob1, d2c3ob2, d2c3ob3, d2c3ob4 automatically matched to d1b0pa5 complexed with ca, mg, pyr, sf4, tpp |
PDB Entry: 2c3o (more details), 2.7 Å
SCOP Domain Sequences for d2c3oa5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c3oa5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip
Timeline for d2c3oa5: