Lineage for d2c3oa3 (2c3o A:259-415)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 834846Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 834847Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 834957Family c.48.1.3: Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52931] (1 protein)
  6. 834958Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52932] (1 species)
  7. 834959Species Desulfovibrio africanus [TaxId:873] [52933] (10 PDB entries)
  8. 834976Domain d2c3oa3: 2c3o A:259-415 [129752]
    Other proteins in same PDB: d2c3oa1, d2c3oa2, d2c3oa4, d2c3oa5, d2c3ob1, d2c3ob2, d2c3ob4, d2c3ob5
    automatically matched to d1b0pa3
    complexed with ca, mg, pyr, sf4, tpp

Details for d2c3oa3

PDB Entry: 2c3o (more details), 2.7 Å

PDB Description: crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (A:) pyruvate-ferredoxin oxidoreductase

SCOP Domain Sequences for d2c3oa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3oa3 c.48.1.3 (A:259-415) Pyruvate-ferredoxin oxidoreductase, PFOR, domain II {Desulfovibrio africanus [TaxId: 873]}
klfdyvgapdaervivsmgsscetieevinhlaakgekiglikvrlyrpfvseaffaalp
asakvitvldrtkepgapgdplyldvcsafvergeampkilagryglgskefspamvksv
ydnmsgakknhftvgieddvtgtslpvdnafadttpk

SCOP Domain Coordinates for d2c3oa3:

Click to download the PDB-style file with coordinates for d2c3oa3.
(The format of our PDB-style files is described here.)

Timeline for d2c3oa3: