Lineage for d2c3mb5 (2c3m B:669-785)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861004Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 861105Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 861182Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species)
  7. 861183Species Desulfovibrio africanus [TaxId:873] [54890] (10 PDB entries)
  8. 861187Domain d2c3mb5: 2c3m B:669-785 [129749]
    Other proteins in same PDB: d2c3ma1, d2c3ma2, d2c3ma3, d2c3ma4, d2c3mb1, d2c3mb2, d2c3mb3, d2c3mb4
    automatically matched to d1b0pa5
    complexed with ca, cl, mg, sf4, tpp

Details for d2c3mb5

PDB Entry: 2c3m (more details), 1.84 Å

PDB Description: crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (B:) pyruvate-ferredoxin oxidoreductase

SCOP Domain Sequences for d2c3mb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3mb5 d.58.1.5 (B:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]}
tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg
kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip

SCOP Domain Coordinates for d2c3mb5:

Click to download the PDB-style file with coordinates for d2c3mb5.
(The format of our PDB-style files is described here.)

Timeline for d2c3mb5: