![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
![]() | Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) ![]() |
![]() | Family c.48.1.3: Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52931] (1 protein) |
![]() | Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52932] (1 species) |
![]() | Species Desulfovibrio africanus [TaxId:873] [52933] (10 PDB entries) |
![]() | Domain d2c3mb3: 2c3m B:259-415 [129747] Other proteins in same PDB: d2c3ma1, d2c3ma2, d2c3ma4, d2c3ma5, d2c3mb1, d2c3mb2, d2c3mb4, d2c3mb5 automatically matched to d1b0pa3 complexed with ca, cl, mg, sf4, tpp |
PDB Entry: 2c3m (more details), 1.84 Å
SCOP Domain Sequences for d2c3mb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c3mb3 c.48.1.3 (B:259-415) Pyruvate-ferredoxin oxidoreductase, PFOR, domain II {Desulfovibrio africanus [TaxId: 873]} klfdyvgapdaervivsmgsscetieevinhlaakgekiglikvrlyrpfvseaffaalp asakvitvldrtkepgapgdplyldvcsafvergeampkilagryglgskefspamvksv ydnmsgakknhftvgieddvtgtslpvdnafadttpk
Timeline for d2c3mb3: