Lineage for d2c3ma4 (2c3m A:416-668)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704438Fold c.64: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53322] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 231456; strand 3 is antiparallel to the rest
  4. 704439Superfamily c.64.1: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53323] (1 family) (S)
  5. 704440Family c.64.1.1: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53324] (1 protein)
  6. 704441Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53325] (1 species)
    also includes linker domain IV
  7. 704442Species Desulfovibrio africanus [TaxId:873] [53326] (9 PDB entries)
  8. 704445Domain d2c3ma4: 2c3m A:416-668 [129743]
    Other proteins in same PDB: d2c3ma1, d2c3ma2, d2c3ma3, d2c3ma5, d2c3mb1, d2c3mb2, d2c3mb3, d2c3mb5
    automatically matched to d1b0pa4
    complexed with ca, cl, mg, sf4, tpp

Details for d2c3ma4

PDB Entry: 2c3m (more details), 1.84 Å

PDB Description: crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (A:) pyruvate-ferredoxin oxidoreductase

SCOP Domain Sequences for d2c3ma4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3ma4 c.64.1.1 (A:416-668) Pyruvate-ferredoxin oxidoreductase, PFOR, domain III {Desulfovibrio africanus [TaxId: 873]}
gtiqcqfwglgadgtvgankqaikiigdntdlfaqgyfsydskksggitishlrfgekpi
qstylvnradyvachnpayvgiydilegikdggtfvlnspwssledmdkhlpsgikrtia
nkklkfynidavkiatdvglggrinmimqtaffklagvlpfekavdllkksihkaygkkg
ekivkmntdavdqavtslqefkypdswkdapaetkaepmtneffknvvkpiltqqgdklp
vsafeadgrfplg

SCOP Domain Coordinates for d2c3ma4:

Click to download the PDB-style file with coordinates for d2c3ma4.
(The format of our PDB-style files is described here.)

Timeline for d2c3ma4: