![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.12: PFOR PP module [88771] (1 protein) domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains |
![]() | Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI [88772] (1 species) |
![]() | Species Desulfovibrio africanus [TaxId:873] [88773] (10 PDB entries) |
![]() | Domain d2c3ma2: 2c3m A:786-1232 [129741] Other proteins in same PDB: d2c3ma1, d2c3ma3, d2c3ma4, d2c3ma5, d2c3mb1, d2c3mb3, d2c3mb4, d2c3mb5 automatically matched to d1b0pa2 complexed with ca, cl, mg, sf4, tpp |
PDB Entry: 2c3m (more details), 1.84 Å
SCOP Domain Sequences for d2c3ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c3ma2 c.36.1.12 (A:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]} vksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcssiwg asapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesdasgd vkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifggdgw aydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtgkkdl armvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmgksqd vmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsfpeda krlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtpmmar pdsgeacdqnragtseqqgdlskrtkk
Timeline for d2c3ma2: