Lineage for d2c3ma2 (2c3m A:786-1232)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694610Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 694611Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 695064Family c.36.1.12: PFOR PP module [88771] (1 protein)
    domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains
  6. 695065Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI [88772] (1 species)
  7. 695066Species Desulfovibrio africanus [TaxId:873] [88773] (9 PDB entries)
  8. 695069Domain d2c3ma2: 2c3m A:786-1232 [129741]
    Other proteins in same PDB: d2c3ma1, d2c3ma3, d2c3ma4, d2c3ma5, d2c3mb1, d2c3mb3, d2c3mb4, d2c3mb5
    automatically matched to d1b0pa2
    complexed with ca, cl, mg, sf4, tpp

Details for d2c3ma2

PDB Entry: 2c3m (more details), 1.84 Å

PDB Description: crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (A:) pyruvate-ferredoxin oxidoreductase

SCOP Domain Sequences for d2c3ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3ma2 c.36.1.12 (A:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]}
vksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcssiwg
asapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesdasgd
vkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifggdgw
aydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtgkkdl
armvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmgksqd
vmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsfpeda
krlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtpmmar
pdsgeacdqnragtseqqgdlskrtkk

SCOP Domain Coordinates for d2c3ma2:

Click to download the PDB-style file with coordinates for d2c3ma2.
(The format of our PDB-style files is described here.)

Timeline for d2c3ma2: