![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Protein NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase, middle domain [418949] (1 species) |
![]() | Species Xanthobacter sp., py2 [TaxId:35809] [419405] (5 PDB entries) |
![]() | Domain d2c3db2: 2c3d B:193-313 [129735] Other proteins in same PDB: d2c3da1, d2c3da3, d2c3db1, d2c3db3 automated match to d1mo9a2 complexed with com, fad |
PDB Entry: 2c3d (more details), 2.15 Å
SCOPe Domain Sequences for d2c3db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c3db2 c.3.1.5 (B:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase, middle domain {Xanthobacter sp., py2 [TaxId: 35809]} gvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrtvmlvrteplkli kdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpngemrietdfvflgl g
Timeline for d2c3db2: