SCOPe 2.08: Domain d2c3db1: 2c3d B:2-192,B:314-383

Lineage for d2c3db1 (2c3d B:2-192,B:314-383)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase, N- and C-terminal domain [418948] (1 species)

7. Species Xanthobacter sp., py2 [TaxId:35809] [419404] (5 PDB entries)

8. Domain d2c3db1: 2c3d B:2-192,B:314-383 [129734]
   Other proteins in same PDB: d2c3da2, d2c3da3, d2c3db2, d2c3db3
   automated match to d1mo9a1
   complexed with com, fad
   has additional insertions and/or extensions that are not grouped together

Details for d2c3db1

PDB Entry: 2c3d, 2.15 Å

PDB Description: 2.15 angstrom crystal structure of 2-ketopropyl coenzyme m oxidoreductase carboxylase with a coenzyme m disulfide bound at the active site

PDB Compounds: (B:) 2-oxopropyl-com reductase

SCOPe Domain Sequences for d2c3db1:

Sequence; same for both SEQRES and ATOM records:

>d2c3db1 c.3.1.5 (B:2-192,B:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase, N- and C-terminal domain {Xanthobacter sp., py2 [TaxId: 35809]}
kvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsay
lramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvvg
ikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlila
vgagpgtldvpXeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpmem
fkarksgcyaarnvmgekisyt

Timeline for d2c3db1:

• d2c3db1 first appeared in SCOP 1.73
  
• d2c3db1 appears in SCOPe 2.07