SCOPe 2.07: Domain d2c3cb3: 2c3c B:384-523

Lineage for d2c3cb3 (2c3c B:384-523)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)

6. Protein NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase [82726] (1 species)

7. Species Xanthobacter sp., py2 [TaxId:35809] [82727] (5 PDB entries)

8. Domain d2c3cb3: 2c3c B:384-523 [129730]
   Other proteins in same PDB: d2c3ca1, d2c3ca2, d2c3cb1, d2c3cb2
   automated match to d1mo9a3
   complexed with acn, com, fad, nap

Details for d2c3cb3

PDB Entry: 2c3c, 2.15 Å

PDB Description: 2.01 angstrom x-ray crystal structure of a mixed disulfide between coenzyme m and nadph-dependent oxidoreductase 2-ketopropyl coenzyme m carboxylase

PDB Compounds: (B:) 2-oxopropyl-com reductase

SCOPe Domain Sequences for d2c3cb3:

Sequence; same for both SEQRES and ATOM records:

>d2c3cb3 d.87.1.1 (B:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}
pknypdflhthyevsflgmgeeearaagheivtikmppdtenglnvalpasdrtmlyafg
kgtahmsgfqkividaktrkvlgahhvgygakdafqylnvlikqgltvdelgdmdelfln
pthfiqlsrlragsknlvsl

Timeline for d2c3cb3:

• d2c3cb3 first appeared in SCOP 1.73
  
• d2c3cb3 appears in SCOPe 2.06
  
• d2c3cb3 appears in the current release, SCOPe 2.08