SCOP 1.75: Domain d2c3cb2: 2c3c B:193-313

Lineage for d2c3cb2 (2c3c B:193-313)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase [82313] (1 species)

7. Species Xanthobacter sp., py2 [TaxId:35809] [82314] (4 PDB entries)

8. Domain d2c3cb2: 2c3c B:193-313 [129729]
   Other proteins in same PDB: d2c3ca3, d2c3cb3
   automatically matched to d1mo9a2
   complexed with acn, com, fad, nap

Details for d2c3cb2

PDB Entry: 2c3c, 2.15 Å

PDB Description: 2.01 angstrom x-ray crystal structure of a mixed disulfide between coenzyme m and nadph-dependent oxidoreductase 2-ketopropyl coenzyme m carboxylase

PDB Compounds: (B:) 2-oxopropyl-com reductase

SCOP Domain Sequences for d2c3cb2:

Sequence; same for both SEQRES and ATOM records:

>d2c3cb2 c.3.1.5 (B:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}
gvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrtvmlvrteplkli
kdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpngemrietdfvflgl
g

Timeline for d2c3cb2:

• d2c3cb2 first appeared in SCOP 1.73
  
• d2c3cb2 appears in SCOPe 2.01
  
• d2c3cb2 appears in the current release, SCOPe 2.08