Lineage for d2c3ca1 (2c3c A:2-192,A:314-383)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2850109Protein NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase, N- and C-terminal domain [418948] (1 species)
  7. 2850110Species Xanthobacter sp., py2 [TaxId:35809] [419404] (5 PDB entries)
  8. 2850115Domain d2c3ca1: 2c3c A:2-192,A:314-383 [129725]
    Other proteins in same PDB: d2c3ca2, d2c3ca3, d2c3cb2, d2c3cb3
    automated match to d1mo9a1
    complexed with acn, com, fad, nap

    has additional insertions and/or extensions that are not grouped together

Details for d2c3ca1

PDB Entry: 2c3c (more details), 2.15 Å

PDB Description: 2.01 angstrom x-ray crystal structure of a mixed disulfide between coenzyme m and nadph-dependent oxidoreductase 2-ketopropyl coenzyme m carboxylase
PDB Compounds: (A:) 2-oxopropyl-com reductase

SCOPe Domain Sequences for d2c3ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3ca1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase, N- and C-terminal domain {Xanthobacter sp., py2 [TaxId: 35809]}
kvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsay
lramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvvg
ikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlila
vgagpgtldvpXeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpmem
fkarksgcyaarnvmgekisyt

SCOPe Domain Coordinates for d2c3ca1:

Click to download the PDB-style file with coordinates for d2c3ca1.
(The format of our PDB-style files is described here.)

Timeline for d2c3ca1: