SCOPe 2.07: Domain d2c3bb_: 2c3b B:

Lineage for d2c3bb_ (2c3b B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (21 species)
   not a true protein

7. Species Aspergillus fumigatus [TaxId:5085] [187014] (1 PDB entry)

8. Domain d2c3bb_: 2c3b B: [129724]
   Other proteins in same PDB: d2c3ba1
   automated match to d1ista_
   complexed with so4

Details for d2c3bb_

PDB Entry: 2c3b, 1.85 Å

PDB Description: the crystal structure of aspergillus fumigatus cyclophilin reveals 3d domain swapping of a central element

PDB Compounds: (B:) ppiase

SCOPe Domain Sequences for d2c3bb_:

Sequence, based on SEQRES records:

>d2c3bb_ b.62.1.1 (B:) automated matches {Aspergillus fumigatus [TaxId: 5085]}
msqvffdveyapvgtaetkvgrivfnlfdkdvpktaknfrelckrpagegyrestfhrii
pnfmiqggdftrgngtggrsiygdkfadenfsrkhdkkgilsmanagpntngsqffitta
vtswldgkhvvfgevadeksysvvkeiealgsssgsvrsntrpkivncgel

Sequence, based on observed residues (ATOM records):

>d2c3bb_ b.62.1.1 (B:) automated matches {Aspergillus fumigatus [TaxId: 5085]}
msqvffdveyapvgtaetkvgrivfnlfdkdvpktaknfrelckrpagegyrestfhrii
pnfmiqggdkkgilsmasqffittavtswldgkhvvfgevadeksysvvkeiealgsssg
svrsntrpkivncgel

Timeline for d2c3bb_:

• d2c3bb_ first appeared in SCOP 1.73, called d2c3bb1
  
• d2c3bb_ appears in SCOPe 2.06
  
• d2c3bb_ appears in the current release, SCOPe 2.08