Lineage for d2c3bb_ (2c3b B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806997Protein automated matches [190077] (22 species)
    not a true protein
  7. 2806998Species Aspergillus fumigatus [TaxId:5085] [187014] (1 PDB entry)
  8. 2806999Domain d2c3bb_: 2c3b B: [129724]
    Other proteins in same PDB: d2c3ba1
    automated match to d1ista_
    complexed with so4

Details for d2c3bb_

PDB Entry: 2c3b (more details), 1.85 Å

PDB Description: the crystal structure of aspergillus fumigatus cyclophilin reveals 3d domain swapping of a central element
PDB Compounds: (B:) ppiase

SCOPe Domain Sequences for d2c3bb_:

Sequence, based on SEQRES records: (download)

>d2c3bb_ b.62.1.1 (B:) automated matches {Aspergillus fumigatus [TaxId: 5085]}
msqvffdveyapvgtaetkvgrivfnlfdkdvpktaknfrelckrpagegyrestfhrii
pnfmiqggdftrgngtggrsiygdkfadenfsrkhdkkgilsmanagpntngsqffitta
vtswldgkhvvfgevadeksysvvkeiealgsssgsvrsntrpkivncgel

Sequence, based on observed residues (ATOM records): (download)

>d2c3bb_ b.62.1.1 (B:) automated matches {Aspergillus fumigatus [TaxId: 5085]}
msqvffdveyapvgtaetkvgrivfnlfdkdvpktaknfrelckrpagegyrestfhrii
pnfmiqggdkkgilsmasqffittavtswldgkhvvfgevadeksysvvkeiealgsssg
svrsntrpkivncgel

SCOPe Domain Coordinates for d2c3bb_:

Click to download the PDB-style file with coordinates for d2c3bb_.
(The format of our PDB-style files is described here.)

Timeline for d2c3bb_: