Lineage for d2c3ba1 (2c3b A:1-171)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674493Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 674494Superfamily b.62.1: Cyclophilin-like [50891] (3 families) (S)
  5. 674495Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 protein domains)
  6. 674496Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 674497Species Aspergillus fumigatus [TaxId:5085] [141499] (1 PDB entry)
  8. 674498Domain d2c3ba1: 2c3b A:1-171 [129723]
    complexed with so4

Details for d2c3ba1

PDB Entry: 2c3b (more details), 1.85 Å

PDB Description: the crystal structure of aspergillus fumigatus cyclophilin reveals 3d domain swapping of a central element
PDB Compounds: (A:) ppiase

SCOP Domain Sequences for d2c3ba1:

Sequence, based on SEQRES records: (download)

>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]}
msqvffdveyapvgtaetkvgrivfnlfdkdvpktaknfrelckrpagegyrestfhrii
pnfmiqggdftrgngtggrsiygdkfadenfsrkhdkkgilsmanagpntngsqffitta
vtswldgkhvvfgevadeksysvvkeiealgsssgsvrsntrpkivncgel

Sequence, based on observed residues (ATOM records): (download)

>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]}
msqvffdveyapvgtaetkvgrivfnlfdkdvpktaknfrelckrpagegyrestfhrii
pnfmiqggdsrkhdkkgilsmaqffittavtswldgkhvvfgevadeksysvvkeiealg
sssgsvrsntrpkivncgel

SCOP Domain Coordinates for d2c3ba1:

Click to download the PDB-style file with coordinates for d2c3ba1.
(The format of our PDB-style files is described here.)

Timeline for d2c3ba1: