Lineage for d2c35h1 (2c35 H:78-171)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2789696Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (4 species)
  7. 2789706Species Human (Homo sapiens) [TaxId:9606] [141309] (1 PDB entry)
    Uniprot P62487 78-171
  8. 2789710Domain d2c35h1: 2c35 H:78-171 [129721]
    Other proteins in same PDB: d2c35a1, d2c35b2, d2c35c_, d2c35d2, d2c35e_, d2c35f2, d2c35g_, d2c35h2
    automated match to d2c35b1
    has additional insertions and/or extensions that are not grouped together

Details for d2c35h1

PDB Entry: 2c35 (more details), 2.7 Å

PDB Description: subunits rpb4 and rpb7 of human rna polymerase ii
PDB Compounds: (H:) DNA-directed RNA polymerase II 19 kDa polypeptide

SCOPe Domain Sequences for d2c35h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c35h1 b.40.4.5 (H:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]}
rpfkgevvdavvtqvnkvglfteigpmscfisrhsipsemefdpnsnppcyktmdedivi
qqddeirlkivgtrvdkndifaigslmddylglv

SCOPe Domain Coordinates for d2c35h1:

Click to download the PDB-style file with coordinates for d2c35h1.
(The format of our PDB-style files is described here.)

Timeline for d2c35h1: