Lineage for d2c35g1 (2c35 G:14-139)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 643210Superfamily a.60.8: HRDC-like [47819] (4 families) (S)
  5. 643224Family a.60.8.2: RNA polymerase II subunit RBP4 (RpoF) [69044] (1 protein)
  6. 643225Protein RNA polymerase II subunit RBP4 (RpoF) [69045] (3 species)
    includes the N-terminal heterodimerisation alpha-hairpin
  7. 643232Species Human (Homo sapiens) [TaxId:9606] [140642] (1 PDB entry)
  8. 643236Domain d2c35g1: 2c35 G:14-139 [129720]
    Other proteins in same PDB: d2c35b1, d2c35b2, d2c35d1, d2c35d2, d2c35f1, d2c35f2, d2c35h1, d2c35h2
    automatically matched to 2C35 A:14-142

Details for d2c35g1

PDB Entry: 2c35 (more details), 2.7 Å

PDB Description: subunits rpb4 and rpb7 of human rna polymerase ii
PDB Compounds: (G:) DNA-directed RNA polymerase II 16 kda polypeptide

SCOP Domain Sequences for d2c35g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c35g1 a.60.8.2 (G:14-139) RNA polymerase II subunit RBP4 (RpoF) {Human (Homo sapiens) [TaxId: 9606]}
eedasqlifpkefetaetllnsevhmllehrkqqnesaedeqelsevfmktlnytarfsr
fknretiasvrslllqkklhkfelaclanlcpetaeeskalipslegrfedeelqqildd
iqtkrs

SCOP Domain Coordinates for d2c35g1:

Click to download the PDB-style file with coordinates for d2c35g1.
(The format of our PDB-style files is described here.)

Timeline for d2c35g1: