| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.60: SAM domain-like [47768] (15 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.8: HRDC-like [47819] (4 families) ![]() |
| Family a.60.8.2: RNA polymerase II subunit RBP4 (RpoF) [69044] (1 protein) |
| Protein RNA polymerase II subunit RBP4 (RpoF) [69045] (3 species) includes the N-terminal heterodimerisation alpha-hairpin |
| Species Human (Homo sapiens) [TaxId:9606] [140642] (1 PDB entry) |
| Domain d2c35g1: 2c35 G:14-139 [129720] Other proteins in same PDB: d2c35b1, d2c35b2, d2c35d1, d2c35d2, d2c35f1, d2c35f2, d2c35h1, d2c35h2 automatically matched to 2C35 A:14-142 |
PDB Entry: 2c35 (more details), 2.7 Å
SCOP Domain Sequences for d2c35g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c35g1 a.60.8.2 (G:14-139) RNA polymerase II subunit RBP4 (RpoF) {Human (Homo sapiens) [TaxId: 9606]}
eedasqlifpkefetaetllnsevhmllehrkqqnesaedeqelsevfmktlnytarfsr
fknretiasvrslllqkklhkfelaclanlcpetaeeskalipslegrfedeelqqildd
iqtkrs
Timeline for d2c35g1: