Lineage for d2c35g_ (2c35 G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716244Superfamily a.60.8: HRDC-like [47819] (5 families) (S)
  5. 2716261Family a.60.8.2: RNA polymerase II subunit RBP4 (RpoF) [69044] (2 proteins)
  6. 2716262Protein RNA polymerase II subunit RBP4 (RpoF) [69045] (3 species)
    includes the N-terminal heterodimerisation alpha-hairpin
  7. 2716266Species Human (Homo sapiens) [TaxId:9606] [140642] (1 PDB entry)
    Uniprot O15514 14-142
  8. 2716270Domain d2c35g_: 2c35 G: [129720]
    Other proteins in same PDB: d2c35b1, d2c35b2, d2c35d1, d2c35d2, d2c35f1, d2c35f2, d2c35h1, d2c35h2
    automated match to d2c35a1
    has additional insertions and/or extensions that are not grouped together

Details for d2c35g_

PDB Entry: 2c35 (more details), 2.7 Å

PDB Description: subunits rpb4 and rpb7 of human rna polymerase ii
PDB Compounds: (G:) DNA-directed RNA polymerase II 16 kda polypeptide

SCOPe Domain Sequences for d2c35g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c35g_ a.60.8.2 (G:) RNA polymerase II subunit RBP4 (RpoF) {Human (Homo sapiens) [TaxId: 9606]}
eedasqlifpkefetaetllnsevhmllehrkqqnesaedeqelsevfmktlnytarfsr
fknretiasvrslllqkklhkfelaclanlcpetaeeskalipslegrfedeelqqildd
iqtkrs

SCOPe Domain Coordinates for d2c35g_:

Click to download the PDB-style file with coordinates for d2c35g_.
(The format of our PDB-style files is described here.)

Timeline for d2c35g_: