Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [141309] (1 PDB entry) Uniprot P62487 78-171 |
Domain d2c35f1: 2c35 F:78-171 [129718] Other proteins in same PDB: d2c35a1, d2c35b2, d2c35c_, d2c35d2, d2c35e_, d2c35f2, d2c35g_, d2c35h2 automated match to d2c35b1 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2c35 (more details), 2.7 Å
SCOPe Domain Sequences for d2c35f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c35f1 b.40.4.5 (F:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} rpfkgevvdavvtqvnkvglfteigpmscfisrhsipsemefdpnsnppcyktmdedivi qqddeirlkivgtrvdkndifaigslmddylglv
Timeline for d2c35f1: