Lineage for d2c35e1 (2c35 E:14-139)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770823Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 771280Superfamily a.60.8: HRDC-like [47819] (4 families) (S)
  5. 771294Family a.60.8.2: RNA polymerase II subunit RBP4 (RpoF) [69044] (1 protein)
  6. 771295Protein RNA polymerase II subunit RBP4 (RpoF) [69045] (3 species)
    includes the N-terminal heterodimerisation alpha-hairpin
  7. 771302Species Human (Homo sapiens) [TaxId:9606] [140642] (1 PDB entry)
    Uniprot O15514 14-142
  8. 771305Domain d2c35e1: 2c35 E:14-139 [129717]
    Other proteins in same PDB: d2c35b1, d2c35b2, d2c35d1, d2c35d2, d2c35f1, d2c35f2, d2c35h1, d2c35h2
    automatically matched to 2C35 A:14-142

Details for d2c35e1

PDB Entry: 2c35 (more details), 2.7 Å

PDB Description: subunits rpb4 and rpb7 of human rna polymerase ii
PDB Compounds: (E:) DNA-directed RNA polymerase II 16 kda polypeptide

SCOP Domain Sequences for d2c35e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c35e1 a.60.8.2 (E:14-139) RNA polymerase II subunit RBP4 (RpoF) {Human (Homo sapiens) [TaxId: 9606]}
eedasqlifpkefetaetllnsevhmllehrkqqnesaedeqelsevfmktlnytarfsr
fknretiasvrslllqkklhkfelaclanlcpetaeeskalipslegrfedeelqqildd
iqtkrs

SCOP Domain Coordinates for d2c35e1:

Click to download the PDB-style file with coordinates for d2c35e1.
(The format of our PDB-style files is described here.)

Timeline for d2c35e1: