SCOPe 2.01: Domain d2c35d1: 2c35 D:78-171

Lineage for d2c35d1 (2c35 D:78-171)

Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds)
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
barrel, closed; n=5, S=8
Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [141309] (1 PDB entry)
Uniprot P62487 78-171
Domain d2c35d1: 2c35 D:78-171 [129715]
Other proteins in same PDB: d2c35a1, d2c35b2, d2c35c1, d2c35d2, d2c35e1, d2c35f2, d2c35g1, d2c35h2
automatically matched to 2C35 B:78-171

Details for d2c35d1

PDB Entry: 2c35 (more details), 2.7 Å

PDB Description: subunits rpb4 and rpb7 of human rna polymerase ii

PDB Compounds: (D:) DNA-directed RNA polymerase II 19 kDa polypeptide

SCOPe Domain Sequences for d2c35d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c35d1 b.40.4.5 (D:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]}
rpfkgevvdavvtqvnkvglfteigpmscfisrhsipsemefdpnsnppcyktmdedivi
qqddeirlkivgtrvdkndifaigslmddylglv

SCOPe Domain Coordinates for d2c35d1:

Click to download the PDB-style file with coordinates for d2c35d1.
(The format of our PDB-style files is described here.)

Timeline for d2c35d1: