Class a: All alpha proteins [46456] (284 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.8: HRDC-like [47819] (4 families) |
Family a.60.8.2: RNA polymerase II subunit RBP4 (RpoF) [69044] (1 protein) |
Protein RNA polymerase II subunit RBP4 (RpoF) [69045] (3 species) includes the N-terminal heterodimerisation alpha-hairpin |
Species Human (Homo sapiens) [TaxId:9606] [140642] (1 PDB entry) Uniprot O15514 14-142 |
Domain d2c35c_: 2c35 C: [129714] Other proteins in same PDB: d2c35b1, d2c35b2, d2c35d1, d2c35d2, d2c35f1, d2c35f2, d2c35h1, d2c35h2 automated match to d2c35a1 |
PDB Entry: 2c35 (more details), 2.7 Å
SCOPe Domain Sequences for d2c35c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c35c_ a.60.8.2 (C:) RNA polymerase II subunit RBP4 (RpoF) {Human (Homo sapiens) [TaxId: 9606]} eedasqlifpkefetaetllnsevhmllehrkqqnesaedeqelsevfmktlnytarfsr fknretiasvrslllqkklhkfelaclanlcpetaeeskalipslegrfedeelqqildd iqtkrsfqy
Timeline for d2c35c_: