SCOPe 2.03: Domain d2c35b1: 2c35 B:78-171

Lineage for d2c35b1 (2c35 B:78-171)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141309] (1 PDB entry)
   Uniprot P62487 78-171

8. Domain d2c35b1: 2c35 B:78-171 [129712]
   Other proteins in same PDB: d2c35a1, d2c35b2, d2c35c_, d2c35d2, d2c35e_, d2c35f2, d2c35g_, d2c35h2

Details for d2c35b1

PDB Entry: 2c35, 2.7 Å

PDB Description: subunits rpb4 and rpb7 of human rna polymerase ii

PDB Compounds: (B:) DNA-directed RNA polymerase II 19 kDa polypeptide

SCOPe Domain Sequences for d2c35b1:

Sequence; same for both SEQRES and ATOM records:

>d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]}
rpfkgevvdavvtqvnkvglfteigpmscfisrhsipsemefdpnsnppcyktmdedivi
qqddeirlkivgtrvdkndifaigslmddylglv

Timeline for d2c35b1:

• d2c35b1 first appeared in SCOP 1.73
  
• d2c35b1 appears in SCOPe 2.02
  
• d2c35b1 appears in SCOPe 2.04
  
• d2c35b1 appears in the current release, SCOPe 2.08