Lineage for d2c34a1 (2c34 A:1-113)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 659292Superfamily b.1.26: ICP-like [141066] (1 family) (S)
    topological variant with similarity to the Cupredoxin-like fold (scop_cf 49502) in the N-terminal region
  5. 659293Family b.1.26.1: ICP-like [141067] (2 proteins)
    PfamB 014070
  6. 659299Protein Inhibitor of cysteine peptidases, ICP [141070] (1 species)
  7. 659300Species Leishmania mexicana [TaxId:5665] [141071] (1 PDB entry)
  8. 659301Domain d2c34a1: 2c34 A:1-113 [129710]

Details for d2c34a1

PDB Entry: 2c34 (more details)

PDB Description: leishmania mexicana icp
PDB Compounds: (A:) inhibitor of cysteine peptidases

SCOP Domain Sequences for d2c34a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c34a1 b.1.26.1 (A:1-113) Inhibitor of cysteine peptidases, ICP {Leishmania mexicana [TaxId: 5665]}
miaplsvkdndkwvdthvgktteihlkgnpttgymwtrvgfvgkdvlsdeilevvckytp
tpsstpmvgvggiyvvlvkprkrghhtlelvytrpfegikpenerytlhlnvk

SCOP Domain Coordinates for d2c34a1:

Click to download the PDB-style file with coordinates for d2c34a1.
(The format of our PDB-style files is described here.)

Timeline for d2c34a1: