Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.26: ICP-like [141066] (2 families) topological variant with similarity to the Cupredoxin-like fold (49502) in the N-terminal region |
Family b.1.26.1: ICP-like [141067] (2 proteins) PfamB PB014070 automatically mapped to Pfam PF09394 |
Protein Inhibitor of cysteine peptidases, ICP [141070] (1 species) |
Species Trypanosome (Leishmania mexicana) [TaxId:5665] [141071] (1 PDB entry) Uniprot Q868H1 1-113 |
Domain d2c34a1: 2c34 A:1-113 [129710] |
PDB Entry: 2c34 (more details)
SCOPe Domain Sequences for d2c34a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c34a1 b.1.26.1 (A:1-113) Inhibitor of cysteine peptidases, ICP {Trypanosome (Leishmania mexicana) [TaxId: 5665]} miaplsvkdndkwvdthvgktteihlkgnpttgymwtrvgfvgkdvlsdeilevvckytp tpsstpmvgvggiyvvlvkprkrghhtlelvytrpfegikpenerytlhlnvk
Timeline for d2c34a1: