Lineage for d2c34a1 (2c34 A:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766737Superfamily b.1.26: ICP-like [141066] (2 families) (S)
    topological variant with similarity to the Cupredoxin-like fold (49502) in the N-terminal region
  5. 2766738Family b.1.26.1: ICP-like [141067] (2 proteins)
    PfamB PB014070
    automatically mapped to Pfam PF09394
  6. 2766751Protein Inhibitor of cysteine peptidases, ICP [141070] (1 species)
  7. 2766752Species Trypanosome (Leishmania mexicana) [TaxId:5665] [141071] (1 PDB entry)
    Uniprot Q868H1 1-113
  8. 2766753Domain d2c34a1: 2c34 A:1-113 [129710]

Details for d2c34a1

PDB Entry: 2c34 (more details)

PDB Description: leishmania mexicana icp
PDB Compounds: (A:) inhibitor of cysteine peptidases

SCOPe Domain Sequences for d2c34a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c34a1 b.1.26.1 (A:1-113) Inhibitor of cysteine peptidases, ICP {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
miaplsvkdndkwvdthvgktteihlkgnpttgymwtrvgfvgkdvlsdeilevvckytp
tpsstpmvgvggiyvvlvkprkrghhtlelvytrpfegikpenerytlhlnvk

SCOPe Domain Coordinates for d2c34a1:

Click to download the PDB-style file with coordinates for d2c34a1.
(The format of our PDB-style files is described here.)

Timeline for d2c34a1: