Lineage for d2c31a3 (2c31 A:370-552)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694610Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 694611Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 694852Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 694933Protein Oxalyl-CoA decarboxylase [142209] (1 species)
  7. 694934Species Oxalobacter formigenes [TaxId:847] [142210] (1 PDB entry)
  8. 694935Domain d2c31a3: 2c31 A:370-552 [129706]
    Other proteins in same PDB: d2c31a1, d2c31a2, d2c31b1, d2c31b2
    complexed with adp, mg, tzd

Details for d2c31a3

PDB Entry: 2c31 (more details), 1.73 Å

PDB Description: crystal structure of oxalyl-coa decarboxylase in complex with the cofactor derivative thiamin-2-thiazolone diphosphate and adenosine diphosphate
PDB Compounds: (A:) oxalyl-coa decarboxylase

SCOP Domain Sequences for d2c31a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c31a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]}
tpsgmmnysnslgvvrdfmlanpdislvneganaldntrmivdmlkprkrldsgtwgvmg
igmgycvaaaavtgkpviavegdsafgfsgmeleticrynlpvtviimnnggiykgnead
pqpgvisctrltrgrydmmmeafggkgyvantpaelkaaleeavasgkpclinamidpda
gve

SCOP Domain Coordinates for d2c31a3:

Click to download the PDB-style file with coordinates for d2c31a3.
(The format of our PDB-style files is described here.)

Timeline for d2c31a3: