Lineage for d2c2wc1 (2c2w C:193-298)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2088835Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
    barrel, closed; n=7, S=10; greek-key topology; one overside connection
  4. 2088836Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) (S)
  5. 2088837Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein)
  6. 2088838Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species)
  7. 2088839Species Streptomyces cattleya [TaxId:29303] [101855] (12 PDB entries)
  8. 2088854Domain d2c2wc1: 2c2w C:193-298 [129702]
    Other proteins in same PDB: d2c2wa2, d2c2wb2, d2c2wc2
    automated match to d1rqpa1
    complexed with 5cd, cl

Details for d2c2wc1

PDB Entry: 2c2w (more details), 2 Å

PDB Description: the fluorinase from streptomyces cattleya is also a chlorinase. structure of 5'-chloro-5'-deoxyadenosine crystallised in the fluorinase.
PDB Compounds: (C:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d2c2wc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2wc1 b.141.1.1 (C:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

SCOPe Domain Coordinates for d2c2wc1:

Click to download the PDB-style file with coordinates for d2c2wc1.
(The format of our PDB-style files is described here.)

Timeline for d2c2wc1: