Lineage for d2c2wa2 (2c2w A:8-192)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 849413Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold
  4. 849414Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (1 family) (S)
  5. 849415Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (1 protein)
  6. 849416Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species)
  7. 849417Species Streptomyces cattleya [TaxId:29303] [102525] (14 PDB entries)
  8. 849439Domain d2c2wa2: 2c2w A:8-192 [129699]
    Other proteins in same PDB: d2c2wa1, d2c2wb1, d2c2wc1
    automatically matched to d1rqpa2
    complexed with 5cd, cl

Details for d2c2wa2

PDB Entry: 2c2w (more details), 2 Å

PDB Description: the fluorinase from streptomyces cattleya is also a chlorinase. structure of 5'-chloro-5'-deoxyadenosine crystallised in the fluorinase.
PDB Compounds: (A:) 5'-fluoro-5'-deoxyadenosine synthase

SCOP Domain Sequences for d2c2wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2wa2 c.132.1.1 (A:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
vrfnr

SCOP Domain Coordinates for d2c2wa2:

Click to download the PDB-style file with coordinates for d2c2wa2.
(The format of our PDB-style files is described here.)

Timeline for d2c2wa2: