![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold |
![]() | Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (1 family) ![]() |
![]() | Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (1 protein) |
![]() | Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species) |
![]() | Species Streptomyces cattleya [TaxId:29303] [102525] (9 PDB entries) |
![]() | Domain d2c2wa2: 2c2w A:8-192 [129699] Other proteins in same PDB: d2c2wa1, d2c2wb1, d2c2wc1 automatically matched to d1rqpa2 complexed with 5cd, cl |
PDB Entry: 2c2w (more details), 2 Å
SCOP Domain Sequences for d2c2wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c2wa2 c.132.1.1 (A:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]} rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei vrfnr
Timeline for d2c2wa2:
![]() Domains from other chains: (mouse over for more information) d2c2wb1, d2c2wb2, d2c2wc1, d2c2wc2 |