Lineage for d2c2vv_ (2c2v V:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1706894Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 1706895Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 1707019Family g.44.1.0: automated matches [191345] (1 protein)
    not a true family
  6. 1707020Protein automated matches [190242] (3 species)
    not a true protein
  7. 1707032Species Mouse (Mus musculus) [TaxId:10090] [187013] (1 PDB entry)
  8. 1707035Domain d2c2vv_: 2c2v V: [129697]
    Other proteins in same PDB: d2c2vb_, d2c2vc1, d2c2ve_, d2c2vf_, d2c2vh_, d2c2vi_, d2c2vk_, d2c2vl_, d2c2vs1
    automated match to d1t1ha_

Details for d2c2vv_

PDB Entry: 2c2v (more details), 2.9 Å

PDB Description: crystal structure of the chip-ubc13-uev1a complex
PDB Compounds: (V:) carboxy terminus of hsp70-interacting protein

SCOPe Domain Sequences for d2c2vv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2vv_ g.44.1.0 (V:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pdylcgkisfelmrepcitpsgitydrkdieehlqrvghfnpvtrspltqeqlipnlamk
evidafiseng

SCOPe Domain Coordinates for d2c2vv_:

Click to download the PDB-style file with coordinates for d2c2vv_.
(The format of our PDB-style files is described here.)

Timeline for d2c2vv_: