![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (4 families) ![]() |
![]() | Family g.44.1.2: U-box [90222] (4 proteins) Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues |
![]() | Protein STIP1 homology and U box-containing protein 1, STUB1 [144224] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [144225] (2 PDB entries) |
![]() | Domain d2c2vt1: 2c2v T:227-301 [129695] Other proteins in same PDB: d2c2vb1, d2c2vc1, d2c2ve1, d2c2vf1, d2c2vh1, d2c2vi1, d2c2vk1, d2c2vl1 automatically matched to 2C2V S:227-301 |
PDB Entry: 2c2v (more details), 2.9 Å
SCOP Domain Sequences for d2c2vt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c2vt1 g.44.1.2 (T:227-301) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} dipdylcgkisfelmrepcitpsgitydrkdieehlqrvghfnpvtrspltqeqlipnla mkevidafisengwv
Timeline for d2c2vt1: