![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (4 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (6 proteins) |
![]() | Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species) |
![]() | Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (2 PDB entries) |
![]() | Domain d2c2vk1: 2c2v K:6-154 [129692] Other proteins in same PDB: d2c2vs1, d2c2vt1, d2c2vu1, d2c2vv1 automatically matched to d1j7db_ |
PDB Entry: 2c2v (more details), 2.9 Å
SCOP Domain Sequences for d2c2vk1:
Sequence, based on SEQRES records: (download)
>d2c2vk1 d.20.1.1 (K:6-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl andvaeqwktneaqaietarawtrlyamn
>d2c2vk1 d.20.1.1 (K:6-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpn dvaeqwktneaqaietarawtrlyamn
Timeline for d2c2vk1: