Lineage for d2c2vf_ (2c2v F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1642804Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1642805Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1642806Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1642988Protein automated matches [190124] (12 species)
    not a true protein
  7. 1642998Species Human (Homo sapiens) [TaxId:9606] [186848] (29 PDB entries)
  8. 1643059Domain d2c2vf_: 2c2v F: [129689]
    Other proteins in same PDB: d2c2vc1, d2c2vs1, d2c2vt_, d2c2vu_, d2c2vv_
    automated match to d1j7da_

Details for d2c2vf_

PDB Entry: 2c2v (more details), 2.9 Å

PDB Description: crystal structure of the chip-ubc13-uev1a complex
PDB Compounds: (F:) Ubiquitin-conjugating enzyme E2 variant 1

SCOPe Domain Sequences for d2c2vf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2vf_ d.20.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmilgpprtiyenriyslk
iecgpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqelrrlm
mskenmklpqppegqcysn

SCOPe Domain Coordinates for d2c2vf_:

Click to download the PDB-style file with coordinates for d2c2vf_.
(The format of our PDB-style files is described here.)

Timeline for d2c2vf_: