Lineage for d2c2vc1 (2c2v C:33-174)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1642804Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1642805Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1642806Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1642814Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1642874Species Human (Homo sapiens), E2 variant 1 [TaxId:9606] [143051] (3 PDB entries)
    Uniprot Q13404 80-221! Uniprot Q13404 82-220
  8. 1642877Domain d2c2vc1: 2c2v C:33-174 [129687]
    Other proteins in same PDB: d2c2vb_, d2c2ve_, d2c2vf_, d2c2vh_, d2c2vi_, d2c2vk_, d2c2vl_, d2c2vs1, d2c2vt_, d2c2vu_, d2c2vv_

Details for d2c2vc1

PDB Entry: 2c2v (more details), 2.9 Å

PDB Description: crystal structure of the chip-ubc13-uev1a complex
PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 variant 1

SCOPe Domain Sequences for d2c2vc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2vc1 d.20.1.1 (C:33-174) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]}
ttgvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmilgpprtiyenriy
slkiecgpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqelr
rlmmskenmklpqppegqcysn

SCOPe Domain Coordinates for d2c2vc1:

Click to download the PDB-style file with coordinates for d2c2vc1.
(The format of our PDB-style files is described here.)

Timeline for d2c2vc1: