Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily) beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology |
Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) |
Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins) |
Protein DinB homolog (DBH) [100881] (2 species) |
Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (41 PDB entries) |
Domain d2c2ra1: 2c2r A:241-341 [129680] Other proteins in same PDB: d2c2ra2 automatically matched to d1n48a1 complexed with 8og, ca, dct, doc |
PDB Entry: 2c2r (more details), 2.55 Å
SCOP Domain Sequences for d2c2ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c2ra1 d.240.1.1 (A:241-341) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]} vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr tfphgisketaysesvkllqkileederkirrigvrfskfi
Timeline for d2c2ra1: