SCOP 1.73: Domain d2c2ld2: 2c2l D:225-304

Lineage for d2c2ld2 (2c2l D:225-304)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (4 families)

5. Family g.44.1.2: U-box [90222] (4 proteins)
   Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues

6. Protein STIP1 homology and U box-containing protein 1, STUB1 [144224] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [144225] (2 PDB entries)

8. Domain d2c2ld2: 2c2l D:225-304 [129679]
   Other proteins in same PDB: d2c2la1, d2c2lb1, d2c2lc1, d2c2ld1
   automatically matched to 2C2L A:225-304
   complexed with ni, so4

Details for d2c2ld2

PDB Entry: 2c2l, 3.3 Å

PDB Description: crystal structure of the chip u-box e3 ubiquitin ligase

PDB Compounds: (D:) carboxy terminus of hsp70-interacting protein

SCOP Domain Sequences for d2c2ld2:

Sequence; same for both SEQRES and ATOM records:

>d2c2ld2 g.44.1.2 (D:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}
krdipdylcgkisfelmrepcitpsgitydrkdieehlqrvghfnpvtrspltqeqlipn
lamkevidafisengwvedy

Timeline for d2c2ld2:

• d2c2ld2 is new in SCOP 1.73
  
• d2c2ld2 appears in SCOP 1.75
  
• d2c2ld2 appears in the current release, SCOPe 2.08