Lineage for d2c2ld1 (2c2l D:24-224)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775786Superfamily a.118.8: TPR-like [48452] (8 families) (S)
  5. 775787Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (17 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 775868Protein STIP1 homology and U box-containing protein 1, STUB1 [140837] (1 species)
  7. 775869Species Mouse (Mus musculus) [TaxId:10090] [140838] (1 PDB entry)
    Uniprot Q9WUD1 24-224
  8. 775873Domain d2c2ld1: 2c2l D:24-224 [129678]
    Other proteins in same PDB: d2c2la2, d2c2lb2, d2c2lc2, d2c2ld2
    automatically matched to 2C2L A:24-224
    complexed with ni, so4

Details for d2c2ld1

PDB Entry: 2c2l (more details), 3.3 Å

PDB Description: crystal structure of the chip u-box e3 ubiquitin ligase
PDB Compounds: (D:) carboxy terminus of hsp70-interacting protein

SCOP Domain Sequences for d2c2ld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2ld1 a.118.8.1 (D:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}
spsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqpeqalad
crraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalria
kkkrwnsieerrihqeselhsyltrliaaerereleecqrnhegheddghiraqqaciea
khdkymadmdelfsqvdekrk

SCOP Domain Coordinates for d2c2ld1:

Click to download the PDB-style file with coordinates for d2c2ld1.
(The format of our PDB-style files is described here.)

Timeline for d2c2ld1: