| Class g: Small proteins [56992] (92 folds) |
| Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
| Family g.44.1.2: U-box [90222] (5 proteins) Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues |
| Protein STIP1 homology and U box-containing protein 1, STUB1 [144224] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [144225] (2 PDB entries) Uniprot Q9WUD1 225-304! Uniprot Q9WUD1 227-301 |
| Domain d2c2lc2: 2c2l C:225-304 [129677] Other proteins in same PDB: d2c2la1, d2c2lb1, d2c2lc1, d2c2ld1 automatically matched to 2C2L A:225-304 complexed with ni, so4 |
PDB Entry: 2c2l (more details), 3.3 Å
SCOPe Domain Sequences for d2c2lc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c2lc2 g.44.1.2 (C:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}
krdipdylcgkisfelmrepcitpsgitydrkdieehlqrvghfnpvtrspltqeqlipn
lamkevidafisengwvedy
Timeline for d2c2lc2: