![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (10 families) ![]() |
![]() | Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
![]() | Protein STIP1 homology and U box-containing protein 1, STUB1 [140837] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [140838] (1 PDB entry) Uniprot Q9WUD1 24-224 |
![]() | Domain d2c2lb1: 2c2l B:24-224 [129674] Other proteins in same PDB: d2c2la2, d2c2lb2, d2c2lc2, d2c2ld2 automatically matched to 2C2L A:24-224 complexed with ni, so4 |
PDB Entry: 2c2l (more details), 3.3 Å
SCOPe Domain Sequences for d2c2lb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c2lb1 a.118.8.1 (B:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} spsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqpeqalad crraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalria kkkrwnsieerrihqeselhsyltrliaaerereleecqrnhegheddghiraqqaciea khdkymadmdelfsqvdekrk
Timeline for d2c2lb1: