Lineage for d2c2lb1 (2c2l B:24-224)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1279354Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1279355Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 1279435Protein STIP1 homology and U box-containing protein 1, STUB1 [140837] (1 species)
  7. 1279436Species Mouse (Mus musculus) [TaxId:10090] [140838] (1 PDB entry)
    Uniprot Q9WUD1 24-224
  8. 1279438Domain d2c2lb1: 2c2l B:24-224 [129674]
    Other proteins in same PDB: d2c2la2, d2c2lb2, d2c2lc2, d2c2ld2
    automatically matched to 2C2L A:24-224
    complexed with ni, so4

Details for d2c2lb1

PDB Entry: 2c2l (more details), 3.3 Å

PDB Description: crystal structure of the chip u-box e3 ubiquitin ligase
PDB Compounds: (B:) carboxy terminus of hsp70-interacting protein

SCOPe Domain Sequences for d2c2lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2lb1 a.118.8.1 (B:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}
spsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqpeqalad
crraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalria
kkkrwnsieerrihqeselhsyltrliaaerereleecqrnhegheddghiraqqaciea
khdkymadmdelfsqvdekrk

SCOPe Domain Coordinates for d2c2lb1:

Click to download the PDB-style file with coordinates for d2c2lb1.
(The format of our PDB-style files is described here.)

Timeline for d2c2lb1: