| Class a: All alpha proteins [46456] (285 folds) |
Superfamily a.118.8: TPR-like [48452] (9 families) ![]() |
| Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
| Protein STIP1 homology and U box-containing protein 1, STUB1 [140837] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [140838] (1 PDB entry) Uniprot Q9WUD1 24-224 |
| Domain d2c2la1: 2c2l A:24-224 [129672] Other proteins in same PDB: d2c2la2, d2c2lb2, d2c2lc2, d2c2ld2 includes linker region 157-224 that forms an alpha hairpin dimerisation subdomain complexed with ni, so4 |
PDB Entry: 2c2l (more details), 3.3 Å
SCOPe Domain Sequences for d2c2la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}
spsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqpeqalad
crraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalria
kkkrwnsieerrihqeselhsyltrliaaerereleecqrnhegheddghiraqqaciea
khdkymadmdelfsqvdekrk
Timeline for d2c2la1: