SCOP 1.75: Domain d2c2la1: 2c2l A:24-224

Lineage for d2c2la1 (2c2l A:24-224)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (8 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (17 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein STIP1 homology and U box-containing protein 1, STUB1 [140837] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140838] (1 PDB entry)
   Uniprot Q9WUD1 24-224

8. Domain d2c2la1: 2c2l A:24-224 [129672]
   Other proteins in same PDB: d2c2la2, d2c2lb2, d2c2lc2, d2c2ld2
   includes linker region 157-224 that forms an alpha hairpin dimerisation subdomain
   complexed with ni, so4

Details for d2c2la1

PDB Entry: 2c2l, 3.3 Å

PDB Description: crystal structure of the chip u-box e3 ubiquitin ligase

PDB Compounds: (A:) carboxy terminus of hsp70-interacting protein

SCOP Domain Sequences for d2c2la1:

Sequence; same for both SEQRES and ATOM records:

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}
spsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqpeqalad
crraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalria
kkkrwnsieerrihqeselhsyltrliaaerereleecqrnhegheddghiraqqaciea
khdkymadmdelfsqvdekrk

Timeline for d2c2la1:

• d2c2la1 first appeared in SCOP 1.73
  
• d2c2la1 appears in SCOPe 2.01
  
• d2c2la1 appears in the current release, SCOPe 2.08