Lineage for d2c2la1 (2c2l A:24-224)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647284Superfamily a.118.8: TPR-like [48452] (4 families) (S)
  5. 647285Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (17 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 647364Protein STIP1 homology and U box-containing protein 1, STUB1 [140837] (1 species)
  7. 647365Species Mouse (Mus musculus) [TaxId:10090] [140838] (1 PDB entry)
  8. 647366Domain d2c2la1: 2c2l A:24-224 [129672]
    Other proteins in same PDB: d2c2la2, d2c2lb2, d2c2lc2, d2c2ld2
    includes linker region 157-224 that forms an alpha hairpin dimerisation subdomain
    complexed with ni, so4

Details for d2c2la1

PDB Entry: 2c2l (more details), 3.3 Å

PDB Description: crystal structure of the chip u-box e3 ubiquitin ligase
PDB Compounds: (A:) carboxy terminus of hsp70-interacting protein

SCOP Domain Sequences for d2c2la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}
spsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqpeqalad
crraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalria
kkkrwnsieerrihqeselhsyltrliaaerereleecqrnhegheddghiraqqaciea
khdkymadmdelfsqvdekrk

SCOP Domain Coordinates for d2c2la1:

Click to download the PDB-style file with coordinates for d2c2la1.
(The format of our PDB-style files is described here.)

Timeline for d2c2la1: