Lineage for d2c2ib1 (2c2i B:2-150)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721376Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 721377Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 721493Family d.38.1.4: MaoC-like [82636] (6 proteins)
  6. 721546Protein Hypothetical protein Rv0130 [143173] (1 species)
  7. 721547Species Mycobacterium tuberculosis [TaxId:1773] [143174] (1 PDB entry)
  8. 721549Domain d2c2ib1: 2c2i B:2-150 [129671]
    automatically matched to 2C2I A:2-150

Details for d2c2ib1

PDB Entry: 2c2i (more details), 1.8 Å

PDB Description: structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis
PDB Compounds: (B:) rv0130

SCOP Domain Sequences for d2c2ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2ib1 d.38.1.4 (B:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]}
rtfesvadlaaaagekvgqsdwvtitqeevnlfadatgdhqwihvdperaaagpfgttia
hgfmtlallprlqhqmytvkgvklainyglnkvrfpapvpvgsrvratsslvgvedlgng
tvqatvsttvevegsakpacvaesivryv

SCOP Domain Coordinates for d2c2ib1:

Click to download the PDB-style file with coordinates for d2c2ib1.
(The format of our PDB-style files is described here.)

Timeline for d2c2ib1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2c2ia1