SCOPe 2.01: Domain d2c2ea2: 2c2e A:2-240

Lineage for d2c2ea2 (2c2e A:2-240)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
   contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)

6. Protein DinB homolog (DBH) [100889] (3 species)

7. Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (50 PDB entries)

8. Domain d2c2ea2: 2c2e A:2-240 [129667]
   Other proteins in same PDB: d2c2ea1
   automatically matched to d1jx4a2
   complexed with ca, dcp

Details for d2c2ea2

PDB Entry: 2c2e, 2.61 Å

PDB Description: efficient and high fidelity incorporation of dctp opposite 7,8-dihydro-8-oxodeoxyguanosine by sulfolobus solfataricus dna polymerase dpo4

PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d2c2ea2:

Sequence; same for both SEQRES and ATOM records:

>d2c2ea2 e.8.1.7 (A:2-240) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
ivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagipi
veakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyrea
ynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldia
dvpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

Timeline for d2c2ea2:

• d2c2ea2 first appeared in SCOP 1.73
  
• d2c2ea2 appears in SCOP 1.75
  
• d2c2ea2 appears in SCOPe 2.02
  
• d2c2ea2 appears in the current release, SCOPe 2.08