Lineage for d2c28a1 (2c28 A:241-342)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008406Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 3008407Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 3008507Family d.240.1.0: automated matches [231323] (1 protein)
    not a true family
  6. 3008508Protein automated matches [231324] (5 species)
    not a true protein
  7. 3008530Species Sulfolobus solfataricus [TaxId:273057] [231327] (33 PDB entries)
  8. 3008535Domain d2c28a1: 2c28 A:241-342 [129660]
    Other proteins in same PDB: d2c28a2
    automated match to d2v4ra2
    complexed with ca, dg

Details for d2c28a1

PDB Entry: 2c28 (more details), 2.27 Å

PDB Description: efficient and high fidelity incorporation of dctp opposite 7,8- dihydro-8-oxodeoxyguanosine by sulfolobus solfataricus dna polymerase dpo4
PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d2c28a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c28a1 d.240.1.0 (A:241-342) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfie

SCOPe Domain Coordinates for d2c28a1:

Click to download the PDB-style file with coordinates for d2c28a1.
(The format of our PDB-style files is described here.)

Timeline for d2c28a1: