Lineage for d2c27a1 (2c27 A:5-310)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731186Protein Mycothiol synthase MshD [103175] (1 species)
    duplication: consists of two NAT domains swapped with the C-terminal strands with both domains binding acetyl-CoA; structural link with the other families
  7. 731187Species Mycobacterium tuberculosis [TaxId:1773] [103176] (3 PDB entries)
    Rv0819
  8. 731190Domain d2c27a1: 2c27 A:5-310 [129659]
    automatically matched to d1ozpa_
    complexed with aco, coa, ma8

Details for d2c27a1

PDB Entry: 2c27 (more details), 1.8 Å

PDB Description: the structure of mycothiol synthase in complex with des- acetylmycothiol and coenzymea.
PDB Compounds: (A:) mycothiol synthase

SCOP Domain Sequences for d2c27a1:

Sequence, based on SEQRES records: (download)

>d2c27a1 d.108.1.1 (A:5-310) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]}
dwrsaltadeqrsvralvtattavdgvapvgeqvlrelgqqrtehllvagsrpggpiigy
lnlspprgaggamaelvvhpqsrrrgigtamaraalaktagrnqfwahgtldparatasa
lglvgvreliqmrrplrdipeptipdgvvirtyagtsddaellrvnnaafaghpeqggwt
avqlaerrgeawfdpdglilafgdsprerpgrllgfhwtkvhpdhpglgevyvlgvdpaa
qrrglgqmltsigivslarrlggrktldpavepavllyvesdnvaavrtyqslgfttysv
dtayal

Sequence, based on observed residues (ATOM records): (download)

>d2c27a1 d.108.1.1 (A:5-310) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]}
dwrsaltadeqrsvralvtattavdgvapvgeqvlrelgqqrtehllvagsgpiigylnl
spprgaggamaelvvhpqsrrrgigtamaraalaktagrnqfwahgtldparatasalgl
vgvreliqmrrplrdipeptipdgvvirtyagtsddaellrvnnaafaghpeqggwtavq
laerrgeawfdpdglilafgdsprerpgrllgfhwtkvhpdhpglgevyvlgvdpaaqrr
glgqmltsigivslarrlktldpavepavllyvesdnvaavrtyqslgfttysvdtayal

SCOP Domain Coordinates for d2c27a1:

Click to download the PDB-style file with coordinates for d2c27a1.
(The format of our PDB-style files is described here.)

Timeline for d2c27a1: