Lineage for d2c27a_ (2c27 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533562Protein automated matches [190241] (13 species)
    not a true protein
  7. 2533612Species Mycobacterium tuberculosis [TaxId:83332] [187012] (1 PDB entry)
  8. 2533613Domain d2c27a_: 2c27 A: [129659]
    automated match to d1ozpa_
    complexed with aco, coa, ma8

Details for d2c27a_

PDB Entry: 2c27 (more details), 1.8 Å

PDB Description: the structure of mycothiol synthase in complex with des- acetylmycothiol and coenzymea.
PDB Compounds: (A:) mycothiol synthase

SCOPe Domain Sequences for d2c27a_:

Sequence, based on SEQRES records: (download)

>d2c27a_ d.108.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dwrsaltadeqrsvralvtattavdgvapvgeqvlrelgqqrtehllvagsrpggpiigy
lnlspprgaggamaelvvhpqsrrrgigtamaraalaktagrnqfwahgtldparatasa
lglvgvreliqmrrplrdipeptipdgvvirtyagtsddaellrvnnaafaghpeqggwt
avqlaerrgeawfdpdglilafgdsprerpgrllgfhwtkvhpdhpglgevyvlgvdpaa
qrrglgqmltsigivslarrlggrktldpavepavllyvesdnvaavrtyqslgfttysv
dtayalag

Sequence, based on observed residues (ATOM records): (download)

>d2c27a_ d.108.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dwrsaltadeqrsvralvtattavdgvapvgeqvlrelgqqrtehllvagsgpiigylnl
spprgaggamaelvvhpqsrrrgigtamaraalaktagrnqfwahgtldparatasalgl
vgvreliqmrrplrdipeptipdgvvirtyagtsddaellrvnnaafaghpeqggwtavq
laerrgeawfdpdglilafgdsprerpgrllgfhwtkvhpdhpglgevyvlgvdpaaqrr
glgqmltsigivslarrlktldpavepavllyvesdnvaavrtyqslgfttysvdtayal
ag

SCOPe Domain Coordinates for d2c27a_:

Click to download the PDB-style file with coordinates for d2c27a_.
(The format of our PDB-style files is described here.)

Timeline for d2c27a_: