SCOPe 2.05: Domain d2c24b_: 2c24 B:

Lineage for d2c24b_ (2c24 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.24: Family 30 carbohydrate binding module, CBM30 (PKD repeat) [110125] (2 proteins)

6. Protein automated matches [190240] (1 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [187011] (1 PDB entry)

8. Domain d2c24b_: 2c24 B: [129658]
   automated match to d1wmxb_

Details for d2c24b_

PDB Entry: 2c24, 2.27 Å

PDB Description: family 30 carbohydrate-binding module of cellulosomal cellulase cel9d-cel44b of clostridium thermocellum

PDB Compounds: (B:) endoglucanase

SCOPe Domain Sequences for d2c24b_:

Sequence, based on SEQRES records:

>d2c24b_ b.18.1.24 (B:) automated matches {Clostridium thermocellum [TaxId: 1515]}
klldvqifkdspvvgwsgsgmgeletigdtlpvdttvtynglptlrlnvqttvqsgwwis
lltlrgwnthdlsqyvengylefdikgkeggedfvigfrdkvyervygleidvttvisny
vtvttdwqhvkiplrdlmkinngfdpssvtclvfskryadpftvwfsdikitsedn

Sequence, based on observed residues (ATOM records):

>d2c24b_ b.18.1.24 (B:) automated matches {Clostridium thermocellum [TaxId: 1515]}
klldvqifkdspvvgwsgsgmgeletigdtlpvdttvtynglptlrlnvqttvgwwisll
tlrgwnthdlsqyvengylefdikgkeggedfvigfrdkvyervygleidvttvisnyvt
vttdwqhvkiplrdlmkinngfdpssvtclvfskryadpftvwfsdikitsedn

Timeline for d2c24b_:

• d2c24b_ first appeared in SCOP 1.73, called d2c24b1
  
• d2c24b_ appears in SCOPe 2.04
  
• d2c24b_ appears in SCOPe 2.06
  
• d2c24b_ appears in the current release, SCOPe 2.08