Lineage for d2c24b_ (2c24 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2369590Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2369591Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2370324Family b.18.1.24: Family 30 carbohydrate binding module, CBM30 (PKD repeat) [110125] (2 proteins)
  6. 2370333Protein automated matches [190240] (1 species)
    not a true protein
  7. 2370334Species Clostridium thermocellum [TaxId:1515] [187011] (1 PDB entry)
  8. 2370336Domain d2c24b_: 2c24 B: [129658]
    automated match to d1wmxb_

Details for d2c24b_

PDB Entry: 2c24 (more details), 2.27 Å

PDB Description: family 30 carbohydrate-binding module of cellulosomal cellulase cel9d-cel44b of clostridium thermocellum
PDB Compounds: (B:) endoglucanase

SCOPe Domain Sequences for d2c24b_:

Sequence, based on SEQRES records: (download)

>d2c24b_ b.18.1.24 (B:) automated matches {Clostridium thermocellum [TaxId: 1515]}
klldvqifkdspvvgwsgsgmgeletigdtlpvdttvtynglptlrlnvqttvqsgwwis
lltlrgwnthdlsqyvengylefdikgkeggedfvigfrdkvyervygleidvttvisny
vtvttdwqhvkiplrdlmkinngfdpssvtclvfskryadpftvwfsdikitsedn

Sequence, based on observed residues (ATOM records): (download)

>d2c24b_ b.18.1.24 (B:) automated matches {Clostridium thermocellum [TaxId: 1515]}
klldvqifkdspvvgwsgsgmgeletigdtlpvdttvtynglptlrlnvqttvgwwisll
tlrgwnthdlsqyvengylefdikgkeggedfvigfrdkvyervygleidvttvisnyvt
vttdwqhvkiplrdlmkinngfdpssvtclvfskryadpftvwfsdikitsedn

SCOPe Domain Coordinates for d2c24b_:

Click to download the PDB-style file with coordinates for d2c24b_.
(The format of our PDB-style files is described here.)

Timeline for d2c24b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2c24a_